Protein Info for RPSI07_RS07715 in Ralstonia solanacearum PSI07

Annotation: chemotaxis response regulator protein-glutamate methylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF00072: Response_reg" amino acids 4 to 104 (101 residues), 53.7 bits, see alignment E=2.2e-18 PF01339: CheB_methylest" amino acids 151 to 327 (177 residues), 194.6 bits, see alignment E=1.2e-61

Best Hits

Swiss-Prot: 71% identical to CHEB4_BURTA: Protein-glutamate methylesterase/protein-glutamine glutaminase 4 (cheB4) from Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 100% identity to rsl:RPSI07_mp1756)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>RPSI07_RS07715 chemotaxis response regulator protein-glutamate methylesterase (Ralstonia solanacearum PSI07)
MNIGIVNDLPLAVAALRRAIARRPEHRVLWVATDGAQAVDFCAAEPPDVVLMDLVMPRSD
GVEATRRIMASSHPCAILVVTSSVGANAWRVYEAMGAGALDAVDTPTLADGDGGAVPLLA
KIDQIGRLAERPVAPVWHASAPRRDDAVPLVAIGASAGGPAALATVLGKLPADFGAGIAI
VQHVDQAFAAGMAAWLDGQTALKVRVGVAGDQPRPGEVLMAATNDHMCVREDGTFGYTCE
PLSTPYRPSVDVFFHSVVACWQGDAIGVLLTGMGRDGAIGLKAMRARGYPTIAQDEATSA
VYGMPKAAAELGAASAILPLDRIADELAARVGK