Protein Info for RPSI07_RS07395 in Ralstonia solanacearum PSI07

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 183 to 207 (25 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 109 (98 residues), 67.7 bits, see alignment E=5.3e-23 PF00528: BPD_transp_1" amino acids 33 to 211 (179 residues), 60.9 bits, see alignment E=7e-21

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to rsl:RPSI07_mp1680)

Predicted SEED Role

"PROBABLE AMINO-ACID TRANSMEMBRANE ABC TRANSPORTER PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>RPSI07_RS07395 amino acid ABC transporter permease (Ralstonia solanacearum PSI07)
MPFDFAVVAEAVPVLLRGLKVTAIVSAIGIPLGMLAGTLAAYAAQPRSLMLACLARGYVA
TVRNIPYLILVYLSFFGLPKLGVPASAMAVAIGCTALYTGGYFCEILRAALCSVPRGQSS
AALSLGMSRWQVQRYIVAPQLLGFLIPPTTSLVIMMFKDSAIFSVMSLPEMTYQSNLLTA
NTFAYTEILAATAAIYWLTSVLLAAAGRSLEHLARRRGLSPQT