Protein Info for RPSI07_RS06625 in Ralstonia solanacearum PSI07

Annotation: cupin domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07883: Cupin_2
  • amino acids 64 to 124 (61 residues), 44.7 bits, E=1.3e-15
• PF02311: AraC_binding
  • amino acids 69 to 160 (92 residues), 27.1 bits, E=4.5e-10
• PF02627: CMD
  • amino acids 179 to 263 (85 residues), 76.7 bits, E=1.7e-25

Best Hits

KEGG orthology group: K01607, 4-carboxymuconolactone decarboxylase [EC: 4.1.1.44] (inferred from 68% identity to lch:Lcho_2144)

Predicted SEED Role

"4-carboxymuconolactone decarboxylase (EC 4.1.1.44)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 4.1.1.44)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (9/9 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (18/35 steps found)
• superpathway of aerobic toluene degradation (11/30 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Protein Sequence (270 amino acids)

>RPSI07_RS06625 cupin domain-containing protein (Ralstonia solanacearum PSI07)
MKPMAIAALALSMLDAAGAAEPELQISRAASRQAQGAPAQDFTGNVKVEMLLVPTGPDRA
SAGTVTFSPGARTAWHTHPLGQTLIVTAGVGRVQRWGGPVEEIRPGDVVRIPPNTKHWHG
AAPNSAMTHIAIQEAQDGKTVDWLEQVSDEQYRAGAATPAAQGPAQPSAAQRLFGDVAPK
LAQLTDDVLFADVWARPGLSPRDRSLVTVSALIAMNRPDQLRSHMALARRNGLTEAELVE
TLTHLAFYTGWPNAVTAAGIAREVFVTKPQ