Protein Info for RPSI07_RS06180 in Ralstonia solanacearum PSI07

Annotation: flagellar biosynthesis protein FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 696 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 308 to 325 (18 residues), see Phobius details TIGR01398: flagellar biosynthesis protein FlhA" amino acids 20 to 691 (672 residues), 884.9 bits, see alignment E=1.8e-270 PF00771: FHIPEP" amino acids 29 to 683 (655 residues), 895.6 bits, see alignment E=1.1e-273

Best Hits

Swiss-Prot: 61% identical to FLHA_SALTY: Flagellar biosynthesis protein FlhA (flhA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 100% identity to rsl:RPSI07_mp1381)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (696 amino acids)

>RPSI07_RS06180 flagellar biosynthesis protein FlhA (Ralstonia solanacearum PSI07)
MNAALLRVSDFLRQGDYRSAAGPVLIILILAMMVLPLPPFILDLLFTFNIALSIIVLLIS
MHTLKPLDFSSFPSILLITTLMRLSLNVASTRVVLMEGHTGPDAAGKVIEAFGHFLVGGN
YTVGIVLFVILIIINFMVISKGAGRIAEVSARFTLDAMPGKQMAIDADLNAGLIREDEAR
RRRQNIAQEAEFFGSMDGASKFVRGDSVAGIAILLINIVGGLAVGVLQHGMDIGHAATNY
TLLTIGDGLVAQIPALVISTAAGIMVSRVSTDKDIGQQLSTELFGMPAVLLTTAGVIGLL
GLVPGMPHFPFILFSGLLGYTGWYLKRKREVPAVQPVLQAIAPVDTPEASWDDVAWVDVL
GLEIGYRLIPLVDKSQDGELLRRIKGIRKKFTQDMGFLAPVVHIRDNLELGPSSYRITLK
GVEIGQGEVQQGKFLAINPGGQAGYSGTQLPGTPTVDPTFGLPALWIGAEVRDRAQAEGY
TVVDCSTVIATHVNQLIYTHSTELLGRLEVQQLLDHLTKEAPKLVEDVVPKLLPIATVQK
VLQNLLDEGLHIRDIRTIVETLAEHGGRTQDPAELTAAVRIALGRAIAQQLFPNKTEMQV
VTLEPNLENILLQSVVGGNAGPIEPQLADSLMQAATDSSRQYEQQGQTGVLLVPPALRPM
LARLFKRAAPSLRVLSHAEIPDHRTIKVIAMLGGRA