Protein Info for RPSI07_RS06025 in Ralstonia solanacearum PSI07

Annotation: adenylyl-sulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00455: adenylyl-sulfate kinase
  • amino acids 4 to 167 (164 residues), 210.2 bits, E=1e-66
• PF01583: APS_kinase
  • amino acids 5 to 158 (154 residues), 206.2 bits, E=1.4e-65

Best Hits

Swiss-Prot: 53% identical to CYSC_PSEE4: Adenylyl-sulfate kinase (cysC) from Pseudomonas entomophila (strain L48)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 100% identity to rsl:RPSI07_mp1348)

MetaCyc: 47% identical to Met14 (Saccharomyces cerevisiae)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.25

Use Curated BLAST to search for 2.7.1.25

Protein Sequence (184 amino acids)

>RPSI07_RS06025 adenylyl-sulfate kinase (Ralstonia solanacearum PSI07)
MKSSPSTLWLTGLSAAGKTTLAYALAQALTAAGAACRILDGDAVRQESSRDLGFSRADRS
QNIRRVADRCRQLNDAGSWAIAAVISPYREDRERARRTVGESRFFEVYLATPLTVCERRD
PKGLYRRARAGEIANFTGISDAYEVPQHPDLRFDTATQPVAECVAATMARLAAVSGQSRL
KAMR