Protein Info for RPSI07_RS05930 in Ralstonia solanacearum PSI07

Annotation: prepilin-type N-terminal cleavage/methylation domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 48 to 70 (23 residues), see Phobius details PF07963: N_methyl" amino acids 44 to 67 (24 residues), 28.7 bits, see alignment (E = 7.2e-11) TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 46 to 68 (23 residues), 26.8 bits, see alignment (E = 3.2e-10) PF12019: GspH" amino acids 83 to 206 (124 residues), 88 bits, see alignment E=6.3e-29

Best Hits

KEGG orthology group: K08084, type IV fimbrial biogenesis protein FimT (inferred from 100% identity to rsl:RPSI07_mp1324)

Predicted SEED Role

"Type IV fimbrial biogenesis protein FimT" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>RPSI07_RS05930 prepilin-type N-terminal cleavage/methylation domain-containing protein (Ralstonia solanacearum PSI07)
MASKLACQRARSAQGFALIEAMVADRSYVQDVVCSYRTAAASGRARGFTLVELVIVISIV
AILVTLAAPSFQSTIQSARTTTEVNSLVNDLQFARSEAIKRGQPVSICVSSDGATCLASN
KWQVGWIVFNDVNGSGALDSTTDVVLRKRAAFAGSDTFVASPTTTVLTYNREGFATGLTN
GTVTMVLHTAPVNQRATRCVAINVVGRQVVQNAGTGSCS