Protein Info for RPSI07_RS05700 in Ralstonia solanacearum PSI07

Annotation: polyisoprenoid-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF04264: YceI" amino acids 25 to 186 (162 residues), 149 bits, see alignment E=6.6e-48

Best Hits

Swiss-Prot: 36% identical to Y3941_PSEU5: UPF0312 protein PST_3941 (PST_3941) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_mp1272)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (191 amino acids)

>RPSI07_RS05700 polyisoprenoid-binding protein (Ralstonia solanacearum PSI07)
MKHLPARLLAALAVAALPASAFAAWEIEPTHTHISFQVGHLGLTKTPGIFRKFETKLNFD
DKDIEASSVTITIDTASIDTANDLRDAELRGPTWLDAQANPRITFVSTSVRHSEGNRYVI
SGNLTVRGKTLPVAFQTTLTARTVNPWLQVPAIGFVGSTRIKRSDFGIAGFPTAISDEVD
LNIALELLKKP