Protein Info for RPSI07_RS05535 in Ralstonia solanacearum PSI07

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 TIGR00229: PAS domain S-box protein" amino acids 5 to 127 (123 residues), 76.5 bits, see alignment E=2e-25 amino acids 134 to 254 (121 residues), 31.5 bits, see alignment E=1.6e-11 PF00989: PAS" amino acids 8 to 108 (101 residues), 46.2 bits, see alignment E=1.5e-15 PF08448: PAS_4" amino acids 13 to 124 (112 residues), 40.3 bits, see alignment E=1.2e-13 PF13426: PAS_9" amino acids 17 to 122 (106 residues), 46.2 bits, see alignment E=1.6e-15 PF08447: PAS_3" amino acids 29 to 106 (78 residues), 49.4 bits, see alignment E=1.6e-16 amino acids 158 to 246 (89 residues), 66.8 bits, see alignment E=6e-22 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 262 to 419 (158 residues), 142.7 bits, see alignment E=8.8e-46 PF00990: GGDEF" amino acids 264 to 419 (156 residues), 163.7 bits, see alignment E=1.1e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_mp1233)

Predicted SEED Role

"FIG00977462: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>RPSI07_RS05535 GGDEF domain-containing protein (Ralstonia solanacearum PSI07)
MLEDHHLYKAAIEHSPIGIGLCAPKGRFLDVNRALCALTGHEAQALRARDLFDLCHPDHA
DRTRERVEALLAGEQDALSLETRFVRPDGSTVWVQADLALARTEAGDGQGGHLIVQVQDV
TARRLALESLQASEQRLAYVLDGAGLGTFDWSMRVRHVSFNRRTAEMLGHAPDELSSDPQ
DWFAMVHPQDAILSLRRIYRHLRGDTDSFEVEQRLRGQEGQWVWVSARGRVTQRDAYGIP
VRVSGTLQDVTRRRAMLDKAHHLALHDPLTDLPNARLLRDRLFVAIQAARRACSQVAVVF
VDLDRFKPINDEYGHGVGDLVLKATAMRLRSGLRASDTVARLGGDEFVAVLTHCQTRDDV
EQTVERLIEQLQAPFRVEGHVLSMGVSAGVALYPADGRDAQTLIRCADAAMYEVKRAGGS
GFGFHASLNYERLMSMRQRGPDPDGEADGR