Protein Info for RPSI07_RS05470 in Ralstonia solanacearum PSI07

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 53 (22 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 104 to 132 (29 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 232 to 255 (24 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 334 to 357 (24 residues), see Phobius details amino acids 359 to 359 (1 residues), see Phobius details amino acids 363 to 384 (22 residues), see Phobius details amino acids 391 to 413 (23 residues), see Phobius details amino acids 425 to 448 (24 residues), see Phobius details PF02447: GntP_permease" amino acids 10 to 447 (438 residues), 532.3 bits, see alignment E=9.3e-164 TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 10 to 450 (441 residues), 498.6 bits, see alignment E=9e-154 PF03600: CitMHS" amino acids 23 to 396 (374 residues), 67.3 bits, see alignment E=1.4e-22

Best Hits

KEGG orthology group: K03299, gluconate:H+ symporter, GntP family (inferred from 100% identity to rsl:RPSI07_mp1219)

Predicted SEED Role

"Gluconate permease" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>RPSI07_RS05470 permease (Ralstonia solanacearum PSI07)
MVPLQGNSLLLAAALAVVALIYLIAVRKLNPFVTLIVVSLALGVAVGMPMGNIVKAFETG
VGNTLGHIALVVGLGTMLGKMMAESGGAERIAKTLIQAFGERNAHWAMMVVAFIIGLPVF
FEVGFVLLIPIAFNVAKRTGTPMLMVGLPMVAGLSVVHGLIPPHPAALLAVTAYQADIGK
TILYALIVGLPTAIIAGPLFAMLISRHVKPDPDNPLEKQFVEADSNRELPPFGITLFTIL
LPVVLMLIGSWADLLTTPKSLANDLLKLAGNSVMALLIAALVSFYTFGRARGFSREAILK
FTNECLAPIATITLVVGAGGGFGQILRDSGVSKAIVAVAMGASLSPLLLGWVVAVMIRIA
TGSATVAMTTACGIVAPIAAASGAAVRPELMVLATGAGSLILSHVNDGGFWLVKEYFNLT
VPQTFQTWTVLETIISIVALLLTLALATVI