Protein Info for RPSI07_RS04825 in Ralstonia solanacearum PSI07

Annotation: APC family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 20 to 69 (50 residues), see Phobius details amino acids 87 to 114 (28 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 287 to 309 (23 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details amino acids 399 to 422 (24 residues), see Phobius details amino acids 428 to 447 (20 residues), see Phobius details PF00324: AA_permease" amino acids 20 to 418 (399 residues), 56.2 bits, see alignment E=2.6e-19 PF13520: AA_permease_2" amino acids 31 to 426 (396 residues), 107 bits, see alignment E=1.2e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_mp1079)

Predicted SEED Role

"cell processes; transport of small molecules; amino acids, amines"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>RPSI07_RS04825 APC family permease (Ralstonia solanacearum PSI07)
MTTNVPAELEGQALGLAESVVMGVAGTAPAFSIAATTATLIGAVGLLAPASLLYCGLIMF
GVTFAYLHLNRLNPSAGAAYAWVGAIFNRTLGFFAGWALLVASVVFMVSGTIPAATATLT
LVAPRLAAQPAAVALAAAGWLLVVSAVIVKGIKLTSYSQIAMTVTETAILLALILLALAK
YGAHPAHAFSWVWLSPGSFTPQLFATGALTALFFFWGWDVTVNLTEETRDASRAPGHGAL
WAMLIVLALFMGFAVVILLVLNDQEIQQSSTNVVFAIADKLLPRPWSYVAVIAVMLSTVG
TLETSILQFTRTLYAKGRDGILHPRYAVLHKRWRTPWVATAVITAIGVLLLFGSSYFPSV
GAIIKDSVNAIGFQVAFYYGLAGFACAWRFRREALRSVFNLVFLLVWPLFSALFLWFIAA
YSVPTFDLATNVVGLGGIALGVVPLMLNRRMAARAAAS