Protein Info for RPSI07_RS04480 in Ralstonia solanacearum PSI07

Annotation: dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 713 transmembrane" amino acids 169 to 186 (18 residues), see Phobius details PF00107: ADH_zinc_N" amino acids 178 to 299 (122 residues), 67.5 bits, see alignment E=1.7e-22 PF01408: GFO_IDH_MocA" amino acids 395 to 507 (113 residues), 65.3 bits, see alignment E=1.3e-21 PF02894: GFO_IDH_MocA_C" amino acids 554 to 633 (80 residues), 29 bits, see alignment E=1.4e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_mp1005)

Predicted SEED Role

"putatve zinc-binding dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (713 amino acids)

>RPSI07_RS04480 dehydrogenase (Ralstonia solanacearum PSI07)
MRQILQDLGSGSTNLMEAPCVAASPGTIVSTTRATLISAGTERMLVDFGRASLLAKARQQ
PEKVKMVLNKIATDGLSTTLSAVRAKLNQPIPLGYCNVGTVHAVGAGVEGFKVGERVVSN
GSHADVVRVPRNLCARIPDEVDDESAVFTVVAAIALQGIRLAQPTLGESFVVTGVGLIGL
LAVQLLRAHGCRVLAIDFDSEKLKLAEQFGAETCNPGLREDPVAAGLAFSRGRGVDGVII
TASTASSEPVTQAAQMCRKRGRIVLVGVTGLELNRADFYEKELSFQVSCSYGPGRYDPAY
EEQGRDYPLGFVRWTEQRNFEAVLDMLADRRLDVRPLITHRIPFDEAPRAYDLLSSDKSA
LGIVLEYKAPPPSTFARRLALIEAPAVFDPAQPVCAFIGAGNYASRVLMPAFRKAGAQLH
SVVTSGGVSGVIHGKPQGFSEASTDVDEVLRDPHVNLIAVATRHSSHASLVIKALRAQKH
VFVEKPLALTLEEIAEVKSTYASAHATGHAAHLMVGFNRRFAPQVVRMKALLSQLNEPKS
FIMTMNAGAIPPHHWTQDLASGGGRIIGEACHFIDLMRFLADSEIVSVQARRMGDHEAVA
VTEDKASITLGFADGSFGTIHYFANGSSAFPKERVEVFCGGRVLQLDNFRKLRGYGWPGF
RSMNLWRQDKGQDACAAAFLRALEGGASTPIPSAEIFEVARVSILAAKQLREQ