Protein Info for RPSI07_RS04460 in Ralstonia solanacearum PSI07

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF17836: PglD_N" amino acids 5 to 82 (78 residues), 25.3 bits, see alignment E=1.9e-09 TIGR03570: sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family" amino acids 6 to 211 (206 residues), 167.4 bits, see alignment E=1.5e-53 PF00132: Hexapep" amino acids 121 to 155 (35 residues), 28.4 bits, see alignment 9.5e-11

Best Hits

Swiss-Prot: 52% identical to PERB_ECO57: GDP-perosamine N-acetyltransferase (perB) from Escherichia coli O157:H7

KEGG orthology group: K00680, [EC: 2.3.1.-] (inferred from 93% identity to rso:RS02341)

MetaCyc: 52% identical to dTDP-viosamine (S)-3-hydroxybutanoyltransferase (Escherichia coli O49)
2.3.1.-

Predicted SEED Role

"2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (EC 2.3.1.89)" in subsystem Lysine Biosynthesis DAP Pathway (EC 2.3.1.89)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>RPSI07_RS04460 acetyltransferase (Ralstonia solanacearum PSI07)
MILIGVYGASGFGREVMPLVREQMRAAGQSYEVVFVDDGADGGAGNGHRVLTYPQFLAEP
AADKRLCFAIAAGQVREKLATRAANDGIACLDVRAANTVVLDAVEIGTGAVLCPFVTLTS
NIRIGKHFHANIYAYVAHDCVIGDYVTFAPGAKCNGNVVIEDHAYVGTGAVLKQGKPGAP
LVIGKGAVVGMGAVVTRDVPAGTTVVGNPARPLVK