Protein Info for RPSI07_RS04445 in Ralstonia solanacearum PSI07

Annotation: polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 666 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details PF13727: CoA_binding_3" amino acids 85 to 244 (160 residues), 45.4 bits, see alignment E=3.4e-15 PF04321: RmlD_sub_bind" amino acids 289 to 430 (142 residues), 40 bits, see alignment E=8.8e-14 PF01370: Epimerase" amino acids 289 to 509 (221 residues), 78.1 bits, see alignment E=2.6e-25 PF02719: Polysacc_synt_2" amino acids 289 to 577 (289 residues), 396.7 bits, see alignment E=2.1e-122 PF01073: 3Beta_HSD" amino acids 290 to 419 (130 residues), 31.2 bits, see alignment E=4.1e-11 PF16363: GDP_Man_Dehyd" amino acids 290 to 413 (124 residues), 45.1 bits, see alignment E=3.3e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_mp0998)

Predicted SEED Role

"Nucleoside-diphosphate sugar epimerase/dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (666 amino acids)

>RPSI07_RS04445 polysaccharide biosynthesis protein (Ralstonia solanacearum PSI07)
MTSTLIRRLLVLPRRSKVLLMVATDVIVLPLCFSLALLLRRGDAELLIQYGALPPVTIAA
LTIPVLYLSGLYRTVVRYIDIKVLWLSGISLATLIALTYFVALSIQQEYLPRTGLLIYWF
IAFSYVVISRFLARTLLRTSLYHKNRGNLTRLAILGAGEAGAQLAQAMHASADHQVLCFF
DHDATLNNTTVAGLPVYGVDRITEQIGRLRINEIVLAIPSASPESRRQVLESLRRFPIKV
RTLPTLLELVDGRITAQSIREIRIEDLLGRDPVPPNKALFAKCTYRRVVMVTGAGGSIGS
ELCRQIATQRPRKLVMLDHSEFALYTIEQELRQSFPDLQLAAHIGSVCDVKAVTAAVSDH
GVDTVYHVAAYKHVPLVESNMAEGIRNNVLGALTVAEVSSTYGVQTCVLVSTDKAVRPTN
IMGASKRMSELVFQAAAARAHTRTTFAMVRFGNVLGSSGSVVPLFRRQIERGGPITVTHA
EAVRYFMLIPEAAQLVIQAGAMAEGGEVFVLDMGKPVRIADLARAMIEMSGLQEKTADNP
GGDIEIKVVGMRPGEKLYEELLIGNDVTPSTHPRIMCSHEHFIPERELKRLLTGLFAACE
SGDTLRIREQVQAIVPEYAPYSSLDGSKPVPTPVERSLLPLPRPFSLLGRSDAEADLDTA
AAAEAS