Protein Info for RPSI07_RS04285 in Ralstonia solanacearum PSI07

Annotation: CPBP family intramembrane metalloprotease domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details transmembrane" amino acids 359 to 381 (23 residues), see Phobius details amino acids 404 to 426 (23 residues), see Phobius details amino acids 448 to 470 (23 residues), see Phobius details amino acids 482 to 502 (21 residues), see Phobius details amino acids 517 to 542 (26 residues), see Phobius details amino acids 553 to 576 (24 residues), see Phobius details amino acids 582 to 599 (18 residues), see Phobius details amino acids 606 to 624 (19 residues), see Phobius details PF02517: Rce1-like" amino acids 532 to 618 (87 residues), 71.4 bits, see alignment E=3.1e-24

Best Hits

KEGG orthology group: K07052, (no description) (inferred from 100% identity to rsl:RPSI07_mp0960)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (625 amino acids)

>RPSI07_RS04285 CPBP family intramembrane metalloprotease domain-containing protein (Ralstonia solanacearum PSI07)
MRQPAHSGMTGVPRWFCNTARRGIGVMMVLAGCAIGAGKGIAAEPSTLTVDQLRTPEQAV
TAVRDAEQRGYERVLAAYEDARKAYPEDVALAVSQCGFVQRFAWSEDSTWSDAASKDLEA
CTAMLEQQHASNPEARLFLLESKYGKAAVTYGEPMLAESSAWTIEQRARLHTALSRAYAG
DHDERRAGEQALLAVQLDPASDRLVPAMRYLAKAKRVDEAGRLLAVAPVPTLAWQESARI
KAAVELLPPGAGRDELQRARDAGLKIDAPTTARALRRAGDTAGAQAALAADTVSRASETG
EMRQLRLDVAFDAGATKAVADALGDWVRKSGVSTPLGYAYTRLIRMDPMAALRPDLLPLA
TWLLFFTAILVLSPAIVLFPAHYRGTVRARLGKPLEPLFARIGLRHAWFAFAVLVAALQL
VPIARFGRDVSDWLPTLGASTDLQRQLALSQIWATGLALLGLSWVVMRLSWREWLGSGRW
RLKWLIPALCCLGPAIFGLFVGRHAVQVDGADAHATLIVALITGMKALGGLPLALLMVAV
VVPVCEELVFRGCLLGGLSRHLSFGWANLWQAVAFAALHQDVKRALFYLLLGLVAGWLTR
KTKGLMAPFLLHAANNAIFVWTWAG