Protein Info for RPSI07_RS03945 in Ralstonia solanacearum PSI07

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 98 to 115 (18 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details amino acids 312 to 330 (19 residues), see Phobius details amino acids 342 to 365 (24 residues), see Phobius details amino acids 371 to 391 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_mp0878)

Predicted SEED Role

"FIG00973969: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>RPSI07_RS03945 hypothetical protein (Ralstonia solanacearum PSI07)
MSASIHPRRLSAILWTVNLSSIAASVFSYVYLSYFVYQRTGNVLLSEWVLLAPMVIPVLL
CLVISRIAGAGTPRGVLVACNTVGLGCALLCYSLLDRFVWPALVAALLIGFLDALQRVAR
TVAVKRYFSTADVKYAVPITLTAQFIAGGVAGVALAFYRTEITPLVANVIVSTGFLLAMF
AARLLPDHREGQGAAAPAPKPRNPLAHLRQLLAQDANLRRHFFAFLIFVSIFQGFFNVSR
VTLPTYVLKLSQSWVGYLQIISASSALAGALLFVWLGKRKITLGRPASVAVSAVALLAMA
GSCGLGQPVGSYVLYFVFMFAWELLFFKYQSDLVAVTPQDQMPLVATFQYAGVYLGMLVT
GTLGGMLTERIGLPACAGVFALVYLVLMPLNARQGRPLARRATSAG