Protein Info for RPSI07_RS03685 in Ralstonia solanacearum PSI07

Annotation: EscN/YscN/HrcN family type III secretion system ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 TIGR01026: ATPase, FliI/YscN family" amino acids 10 to 436 (427 residues), 545.9 bits, see alignment E=6.4e-168 TIGR02546: type III secretion apparatus H+-transporting two-sector ATPase" amino acids 20 to 436 (417 residues), 615.7 bits, see alignment E=3.8e-189 PF02874: ATP-synt_ab_N" amino acids 26 to 91 (66 residues), 34.1 bits, see alignment E=4.9e-12 PF00006: ATP-synt_ab" amino acids 148 to 357 (210 residues), 286.7 bits, see alignment E=1.7e-89 PF18269: T3SS_ATPase_C" amino acids 365 to 433 (69 residues), 76.3 bits, see alignment E=2e-25

Best Hits

Swiss-Prot: 71% identical to HRPB6_XANEU: Probable ATP synthase hrpB6 (hrpB6) from Xanthomonas euvesicatoria

KEGG orthology group: K03224, ATP synthase in type III secretion protein SctN [EC: 3.6.3.14] (inferred from 100% identity to rsl:RPSI07_mp0817)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>RPSI07_RS03685 EscN/YscN/HrcN family type III secretion system ATPase (Ralstonia solanacearum PSI07)
MTHLALLESLENAARTTPLIRRFGKVVEVTGTLLRVGGVDVRLGELCTLTEPDGTVMQEG
EVVGFSEHFALVAPFGGVTGLSRSTRVVPSGRALSVGIGPGLLGRVLDGLGRPADGGPPL
EVVDYVPVFANAPDPMTRRLVEQPLATGVRVIDGLATLAEGQRMGIFAPAGVGKSTLMGM
FARGTDCDVNVIVLIGERGREVREFIEQILGEEGMRRSVVVCATSDRSAVERAKAAYVGT
AVAEYFRDQGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAGM
SAAGSITALYTVLAEDESGNDPVAEEVRGILDGHLILSRDIAARNRYPAIDILNSLSRVM
TQVMPREHCDAAGRMRQLLAKYNEVETLLQMGEYKEGSDPVADAAVQWNDWMESFLRQRT
DEWCSPDETRRLLDDIAQS