Protein Info for RPSI07_RS03190 in Ralstonia solanacearum PSI07

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 67 to 92 (26 residues), see Phobius details amino acids 225 to 237 (13 residues), see Phobius details PF00501: AMP-binding" amino acids 40 to 402 (363 residues), 203 bits, see alignment E=6.7e-64 PF23024: AMP-dom_DIP2-like" amino acids 441 to 550 (110 residues), 28.7 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_mp0712)

Predicted SEED Role

"Capsular polysaccharide biosynthesis fatty acid synthase WcbR" in subsystem Capsular heptose biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (558 amino acids)

>RPSI07_RS03190 membrane protein (Ralstonia solanacearum PSI07)
MTASRAGTLTLTQCLLDREAACDGSVAYRFITHGDLQLLEWSYATLVTYAKRLAAALQHR
RLQRERVLILCAVGEEYTSVFFACVLAGAIAVPCTPLRGTRHRSKIVEIIKRCAPRLVVC
DEASMRPLAELLQSAGLSDIELADPASLAAGNHAWHPPGVTSSDIALLQYTSGSTSDPKG
VVVTHASIMANLAGIEKKFGLGPASRGMVWLPPYHDMGLIGGVLSPVYTGYPITLLSPLL
FIQKPVRWLKLISQYRITVSGGPNFGYQACVERVADSECAGVDLSSWELAFNGAERVNAQ
TLERFTRRFASRGFRGAAHYPTYGMAESTLMISGGTRGSGYKILPAVAGSQHEAKFRDAV
SCGSALDGHELLVVDPASRRPVADGEMGEVWVSGPSVAAGYWGNPSEAFHGQVEGRAGRF
LQTGDLGVLRDGELYLLGRMKEVIIIRGANFFPSDLENAIRGAHDALNPDGVVVFSHAGE
ADESIVVMAELRRDARDAPPEDIKARITAALAGEFDLRPIDVVLLPIGGILRTSSGKPMR
MKMKQLYLQRAEVSELAV