Protein Info for RPSI07_RS02755 in Ralstonia solanacearum PSI07

Annotation: sterol desaturase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 42 to 68 (27 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 231 to 364 (134 residues), 105.3 bits, see alignment E=1.7e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_mp0624)

Predicted SEED Role

"Sterol desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>RPSI07_RS02755 sterol desaturase family protein (Ralstonia solanacearum PSI07)
MTQPQHSATPPEQEPPPALIRVADATVRDANQLLNSSGGLVFGNGLIATILALVLGFLCL
LGVMAFHFPQYLTTPELRHAYSVDVMRQILFFSLLVSGGLALANIVLDNRRRLNGLAFAF
VLAAVALGGSRVQVGDFPDHTPYIGLDWFILDLLGSTVIFVLLEKLFPLYKKQPVFRPEW
QTDMVHFAVNHFIVGLVLLVVNFLIHRVFGWMVHAGFQQMVQHIWFVPQLLLCMLVADLM
EYVTHRAYHEVPFLWRFHAVHHSVKTMDWLAGSRQHILELIVTRVAVLGPLFVLGFDKSV
VDTYIIIVGFQAVFNHANVHLPWGPLKYIFVTPDFHHWHHSSEDEAIDKNYAAHFSFIDY
LFGTAVKSKKAFPEQYGVVGDYMPDGFINQQRFPFRRNPATPATPT