Protein Info for RPSI07_RS02420 in Ralstonia solanacearum PSI07

Annotation: malonic semialdehyde reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF00881: Nitroreductase" amino acids 16 to 155 (140 residues), 57 bits, see alignment E=1.4e-19

Best Hits

KEGG orthology group: K09019, putative NADH dehydrogenase/NAD(P)H nitroreductase RutE [EC: 1.-.-.-] (inferred from 100% identity to rsl:RPSI07_mp0546)

MetaCyc: 52% identical to FAD reductase (NADH) (Cupriavidus nantongensis)
RXN-8506 [EC: 1.5.1.37]

Predicted SEED Role

"Predicted reductase RutE in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.5.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>RPSI07_RS02420 malonic semialdehyde reductase (Ralstonia solanacearum PSI07)
MDKRLSDEGMDLLFRQARTHNRWQAKPVSDDTLRELYELMKWCPTSANCSPARILLLRTQ
EAKQRLLPALAPGNIDKTMSAPVTAIIAYDGKFYDKLPKLFPHADARAWFADTPELAEVT
ARRNSSLQGAYFMLAARSLGLDCGPMSGFDHAKVDHEFFPAAGQTRGFEQEYFPDSHIKT
NFLCNLGYGDPAGLFPRSPRLDFDEACKLL