Protein Info for RPSI07_RS02230 in Ralstonia solanacearum PSI07

Annotation: cobalamin biosynthesis protein CbiD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01888: CbiD
  • amino acids 19 to 285 (267 residues), 271.4 bits, E=3.4e-85
• TIGR00312: cobalamin biosynthesis protein CbiD
  • amino acids 26 to 373 (348 residues), 207.1 bits, E=1.7e-65

Best Hits

Swiss-Prot: 94% identical to CBID_RALSO: Cobalt-precorrin-5B C(1)-methyltransferase (cbiD) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02188, cobalamin biosynthesis protein CbiD (inferred from 100% identity to rsl:RPSI07_mp0506)

Predicted SEED Role

"Cobalt-precorrin-6 synthase, anaerobic" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (13/15 steps found)

Protein Sequence (383 amino acids)

>RPSI07_RS02230 cobalamin biosynthesis protein CbiD (Ralstonia solanacearum PSI07)
MQPPARRPFDLAALAPNGLRRGRTTGACATAAVKAALLRLVRGETVDAVEVSLPDPDYYL
EVPIARVMPLAGGAVRADVLKFAGDDPDNTDGATIFAEVSVNHAGEVRFVAAQGVGTVTQ
PGLRVPPGEPAINPVPRQMMCMAVDEVLAGGANPGFDLAIGCVDGERIARRTFNPMLGIV
GGISILGTSGIVEPMSLAAWMASIEVYVRVALGDAPEAIAFTPGKIGRAYAAHTLALSKK
QVVQIANFVGASLDYAQTALEEDRHRLGTLWVLGHPGKLAKVLDGVWDTHSSKSGMAMGS
VAAVAAELGFAAVLVEQIKTANTVENVIQILQHQPGAQAFWREIEQRIAALMQPKVPRAD
RVAVRLFAMDGTPLGAAHQETGA