Protein Info for RPSI07_RS01900 in Ralstonia solanacearum PSI07

Annotation: HIT family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11969: DcpS_C
  • amino acids 10 to 109 (100 residues), 49.3 bits, E=6.4e-17
• PF01230: HIT
  • amino acids 17 to 113 (97 residues), 103.3 bits, E=9.6e-34

Best Hits

KEGG orthology group: K02503, Hit-like protein involved in cell-cycle regulation (inferred from 100% identity to rsl:RPSI07_mp0431)

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17)" (EC 3.6.1.17)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.17

Protein Sequence (144 amino acids)

>RPSI07_RS01900 HIT family protein (Ralstonia solanacearum PSI07)
MPDPTYDNQNIFAKILRGEMPCIKVYEDEHTLAFMDIMPQADGHVLVLPKEGAAQLFDLS
DDAAAAAIRTTRKLARAVRRAFTPPGIAVFQLNGSAAGQTVPHVHFHVLPRYTDLPLQPH
ARVQADTDKLKTQAEQIIAALRAE