Protein Info for RPSI07_RS01590 in Ralstonia solanacearum PSI07

Annotation: tetratricopeptide repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 PF13428: TPR_14" amino acids 16 to 59 (44 residues), 24.3 bits, see alignment 5.1e-09 PF13432: TPR_16" amino acids 27 to 60 (34 residues), 15.6 bits, see alignment (E = 2.7e-06) amino acids 63 to 119 (57 residues), 17 bits, see alignment 1e-06

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_mp0357)

Predicted SEED Role

"FOG: TPR repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (530 amino acids)

>RPSI07_RS01590 tetratricopeptide repeat-containing protein (Ralstonia solanacearum PSI07)
MTTETLAHSIAEEATPATLLQMAGWHAQSGDPEQAERCYRWVLERDPRHVPALLQLASLL
QSDGQRVSEALPLLDTAIALQPRASALHVSRAIVLNALERRLDALESFAQACCLAPGDPG
ALYNLGLQYADLCCPAQTEVIARHLIGLRPDWPAAHYMLLRALTALEADPAEIEPLYRYL
IKSDPMNVSLRFAHGLMQLKAGNYAAGWDAQEWRWDIEPAKSAQQVFRQPRWAGGPLAGR
RLLIVGEQGFGDILQFARYLPMLVERGAQVILLLDDNRAALARLLGRIEGIEVVVGAQAL
PAFDLYCPLASLPYVFDTAVDSIPVPSYLSVDEADVAAWKQRLAHLPRPWVGLCWAGSSE
HVHNVRRSLPLCTGSRYYAERQARERRIMAVASRVAAACGVDGLDVAAARDALPSGWTMA
PLLERTAGTFVSLQVGAHAADIDTLSASLRARVAAPLPAQPDFYETACLIRALDEVITVD
TSAAHLSGAIGQRGRIITPMAPEWRWIERNGRSAWYPEMQLIPQGAIAGQ