Protein Info for RPSI07_RS01430 in Ralstonia solanacearum PSI07

Annotation: flagellar assembly peptidoglycan hydrolase FlgJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02541: flagellar rod assembly protein/muramidase FlgJ
  • amino acids 11 to 361 (351 residues), 324.5 bits, E=4.5e-101
• PF10135: Rod-binding
  • amino acids 49 to 95 (47 residues), 57.1 bits, 2.1e-19
• PF01832: Glucosaminidase
  • amino acids 222 to 361 (140 residues), 125.1 bits, E=2.7e-40

Best Hits

KEGG orthology group: K02395, flagellar protein FlgJ (inferred from 100% identity to rsl:RPSI07_mp0324)

Predicted SEED Role

"Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)" in subsystem Flagellum (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Protein Sequence (362 amino acids)

>RPSI07_RS01430 flagellar assembly peptidoglycan hydrolase FlgJ (Ralstonia solanacearum PSI07)
MNRTDISNRLALDAQGFESLKQTARTDPTGAAKTVAKQFDAIFVNMMLKQMREASPQSGL
FDSASSKMYTSMFDQQLSQTIASRGVGVADQLLKQMLRQAAKTNPDASGPVNTALSRTTA
TNTALPGAAGSTATDAAKAIARASLNGLAASAAAGTEDDGSGISTVPRPGLDERVQRALA
ALRKQAEAEAQSGGTLPEADLSSVASQPAGDRMSSFYSKLIDHATQASQDTGIPANFMIG
HAALESGWGRREIRAKDGSNTHNLFGIKAGGSWTGPTAEVTTTEYVGGVAHKVKEKFRAY
GSYAEAFKDYANLLSSNPRYSNVVAAGAGKDAASFARGLQRAGYATDPNYANKIMAVLRQ
IA