Protein Info for RPSI07_RS00960 in Ralstonia solanacearum PSI07

Annotation: ferrous iron transport protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 transmembrane" amino acids 224 to 248 (25 residues), see Phobius details amino acids 254 to 270 (17 residues), see Phobius details amino acids 282 to 306 (25 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 361 to 387 (27 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details amino acids 459 to 479 (21 residues), see Phobius details amino acids 496 to 513 (18 residues), see Phobius details amino acids 520 to 542 (23 residues), see Phobius details amino acids 552 to 574 (23 residues), see Phobius details amino acids 594 to 617 (24 residues), see Phobius details PF02421: FeoB_N" amino acids 16 to 176 (161 residues), 181 bits, see alignment E=2.3e-57 PF01926: MMR_HSR1" amino acids 16 to 133 (118 residues), 63.9 bits, see alignment E=3e-21 TIGR00437: ferrous iron transport protein B" amino acids 208 to 588 (381 residues), 317.8 bits, see alignment E=8e-99 PF07670: Gate" amino acids 291 to 386 (96 residues), 76.6 bits, see alignment E=3.8e-25 amino acids 461 to 592 (132 residues), 58.9 bits, see alignment E=1.2e-19 PF07664: FeoB_C" amino acids 403 to 455 (53 residues), 52 bits, see alignment 9.3e-18

Best Hits

KEGG orthology group: K04759, ferrous iron transport protein B (inferred from 100% identity to rsl:RPSI07_mp0217)

Predicted SEED Role

"Ferrous iron transport protein B" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (621 amino acids)

>RPSI07_RS00960 ferrous iron transport protein B (Ralstonia solanacearum PSI07)
MQMHASSSPSSAPALRVALVGNPNCGKTALFNLLTGSRQKVANYAGVTVERKEGRFVAPS
GRHVQILDLPGAYSLVATSPDEAITRDICLGTFRGEPRPDLIVCVVDATNLRLHLRFVLE
LQRLGLPMVLALNMVDAAARRGIRIDRAKLEQALGMPVVETVAIKRNGAADLVTHIDHER
LPAVPTALPADADPHVEVKRLLDAAVTMPRSTAELDDRLDRIVLHPVLGLVLLAVLMFFM
FQAVFSWAKPLMDGIQAVVEDAGVWIGALLPDGMLKSLLVDGIIAGTGSILVFLPQILIL
FLFILALEESGYLPRAAFLLDRLMAGAGLSGRSFIPLLSSFACAIPGVMATRTIQDPRDR
LVTILVAPLMTCSARLPVYALLIGAFIPARQVWGTFNLQGLVLFGLYMAGIVSALLVAYV
LKYLKRDRSEHPLILELPSYRLPSPRNLAIGLIERARIFLRRIGTVILKMMVLLWFLSTF
PSPPAGATGPAIDYSFAGYIGHALEVVFAPIGFNWQMCIALIPGMAAREVAVGALATVYS
LSATREDAAAQLAPVIAAQWPLATALAFLAWYVYAPQCISTLATIRRETNSWKVMASTAG
YLFALAYLAAFATYQIARVLT