Protein Info for RPSI07_RS00145 in Ralstonia solanacearum PSI07

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 214 to 238 (25 residues), see Phobius details PF12729: 4HB_MCP_1" amino acids 32 to 207 (176 residues), 77.9 bits, see alignment E=1.5e-25 PF00672: HAMP" amino acids 235 to 283 (49 residues), 40.5 bits, see alignment 5.8e-14 PF00512: HisKA" amino acids 315 to 378 (64 residues), 44.4 bits, see alignment E=2.8e-15 PF02518: HATPase_c" amino acids 429 to 537 (109 residues), 96 bits, see alignment E=3.9e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_mp0033)

Predicted SEED Role

"FIG00978077: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (540 amino acids)

>RPSI07_RS00145 HAMP domain-containing protein (Ralstonia solanacearum PSI07)
MTRQTHFPASAAKTVPARSVRGLGTPSILRPIRVRLSLVFVTFLLLVIGVGVFSIDQLAS
FHSVSAQISGRWLQSSRILGDLNNDISDYRAAEGDSLIATTSADARAADQQIATLDDMIA
AAQARYDKIEHDAAERELYRQFVTQWTTYRELAKRVRITVKSGEPAGAVQLYHGESRRAY
DSANDTLAVLTERNVAGAAAETEREAQAYRDARHWIIGAIVVAACLVAVAVAYLVLAVSR
PIAALVERMHRIANNDAHVDIPELDRRDEIGDIAQAVARFRDNTIELGRSKDALVSQAVV
LQDMLAKERRMAELQRNFVSMASHEFRTPLGVIDGHAQRLMRMRETPAPEVLEERCGKIR
AAVQRMTHLMDHLLDSSQWLDSTTLAAVRCTHFPLAGLLHEVCEMHRDSAPGTRIEERLD
EGTPEIFYGDAKLLFQAFSNLVGNAVKYSPPHARVTVRISGDAESVCVSVDDQGLGIPER
DIDRLFERYVRGGNVAGTVGAGVGLYLVKLVVELHRGTIAVSSVEGRGSQFVVRLPRLEA