Protein Info for QEN71_RS44405 in Paraburkholderia sabiae LMG 24235

Annotation: IS5 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 243 to 264 (22 residues), see Phobius details PF13340: DUF4096" amino acids 11 to 83 (73 residues), 77.4 bits, see alignment E=1.6e-25 PF01609: DDE_Tnp_1" amino acids 100 to 252 (153 residues), 92 bits, see alignment E=9.2e-30 PF13612: DDE_Tnp_1_3" amino acids 124 to 202 (79 residues), 27.8 bits, see alignment E=4.7e-10 PF13586: DDE_Tnp_1_2" amino acids 180 to 257 (78 residues), 41 bits, see alignment E=4.6e-14

Best Hits

KEGG orthology group: None (inferred from 94% identity to bph:Bphy_4955)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>QEN71_RS44405 IS5 family transposase (Paraburkholderia sabiae LMG 24235)
MKKRRPYPTDVSDEEWYFAAPYLTLMNKDAPQRRYELREMFNALRWIVRAGAPWRLLPND
FPPWELVYQQTQRWIQAGCFEAMVSDLRSIIRVAQDRRGQPSAVILDGRTLQSTCERGAR
AGYDGYKRKKGSKVHMAVDTLGQLLAVHVTPANEQERAQVGELARQVQQATGQTVKVAFA
DQGYTGEEPAQAALDEGVELQVIKLPEAKKGFVLLPRRWVVERSFGWLNRFRRLARDYER
LPETLAGLHFVVFSALMLVHFATFSRSA