Protein Info for QEN71_RS44120 in Paraburkholderia sabiae LMG 24235

Annotation: type IV secretion system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 42 to 59 (18 residues), see Phobius details PF04335: VirB8" amino acids 25 to 229 (205 residues), 85.1 bits, see alignment E=3.5e-28

Best Hits

KEGG orthology group: None (inferred from 58% identity to bge:BC1002_6800)

Predicted SEED Role

"Conjugative transfer protein TrbF" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>QEN71_RS44120 type IV secretion system protein (Paraburkholderia sabiae LMG 24235)
MRIFRNKRQAALSTAPGSFAEEDPAQVIFETSTKLKVEANRWMLMAFAAIAVAGGAVWTR
QPPPSVTKVVGVSANVSGHPVVTELVAYKPDSQAIRTSMNEMAVRWFTIEPVLTDSLNTS
RMSANINSVKAQMIGAATDQFKSWLRDDAPFQQITANPKLIREVNVRNIALLEDQTVLVE
FTTTTSQAGATGKPDVKSYALTLRYQIVAPTADAALTKNPFGIFIPFFRLERTGGA