Protein Info for QEN71_RS43115 in Paraburkholderia sabiae LMG 24235

Annotation: cytochrome c3 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF14522: Cytochrome_C7" amino acids 51 to 91 (41 residues), 25 bits, see alignment 2e-09 amino acids 124 to 216 (93 residues), 27 bits, see alignment E=4.7e-10

Best Hits

KEGG orthology group: None (inferred from 67% identity to reu:Reut_B4427)

Predicted SEED Role

"Molybdopterin oxidoreductase subunit, predicted; chaperone protein HtpG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>QEN71_RS43115 cytochrome c3 family protein (Paraburkholderia sabiae LMG 24235)
MAQAFSQSTVLALKLFSLTAFLLVIAAITAARWYAEPDAKTEEPVEQPIPFSHKHHVGDD
GIDCRYCHTSVEKSAFAGMPSTQICLTCHSQLFTDSPVLAPLHASMDSNTPIHWNRVHDL
PDFVYFDHSIHVNKGVACIECHGRIDEMPLTARVASLDMQWCLQCHRNAPRHIRPLADVF
KMSDIRPLSQQEIGQLNRLFHLQDTRRLTDCSTCHR