Protein Info for QEN71_RS42430 in Paraburkholderia sabiae LMG 24235

Annotation: IS110 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF01548: DEDD_Tnp_IS110" amino acids 14 to 168 (155 residues), 167 bits, see alignment E=4.2e-53 PF02371: Transposase_20" amino acids 277 to 358 (82 residues), 73.9 bits, see alignment E=1.6e-24

Best Hits

Swiss-Prot: 60% identical to YIS1_STRCO: Insertion element IS110 uncharacterized 43.6 kDa protein (SCO1005) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: None (inferred from 96% identity to bxe:Bxe_B0156)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>QEN71_RS42430 IS110 family transposase (Paraburkholderia sabiae LMG 24235)
MQENQQHSSVDVFVGVDVGKGHHHAVALDRTGKRLYNKALPNDEAKLRALITELKTHGQL
LFVVDQPATIGALPVVVARDEGVLVAYLPGLAMRRIADLHAGEAKTDARDAAIIAEAARS
MPHTLRSLRLADEPLAELTMLCGFDDDLAAQITQTSNRIRGLLTQIHPALERVLGPRLDH
PAVLDLLERYPSPAELASASEKTLANRLIKLAPRMGKSLAAEIVRALSEQAVIVPGTQAA
TIVMPRLAQQLASLRKQREEVASEVERLVHAHPLWPVLTSMPGVGVRTAARLLTEVAHKA
FASAAHLAAYAGLAPVTRRSGSSIRGEHPSRRGNKVLKRALFLSAFAALRDPLSRGYYPR
KVQQGKRHNQALIALARRRCDVLFAMLRDGTLYQPKSASTA