Protein Info for QEN71_RS42200 in Paraburkholderia sabiae LMG 24235

Annotation: ferredoxin III, nif-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 TIGR02936: ferredoxin III, nif-specific" amino acids 9 to 97 (89 residues), 126.2 bits, see alignment E=2.1e-41 PF13237: Fer4_10" amino acids 23 to 89 (67 residues), 30.3 bits, see alignment E=1.6e-10 PF00037: Fer4" amino acids 24 to 43 (20 residues), 26.6 bits, see alignment 1.8e-09 PF12837: Fer4_6" amino acids 24 to 42 (19 residues), 26.7 bits, see alignment 1.8e-09 PF13183: Fer4_8" amino acids 26 to 91 (66 residues), 27.3 bits, see alignment E=2e-09 PF13484: Fer4_16" amino acids 27 to 90 (64 residues), 31.3 bits, see alignment E=1.4e-10 PF12838: Fer4_7" amino acids 27 to 92 (66 residues), 42.9 bits, see alignment E=2.5e-14 PF13187: Fer4_9" amino acids 27 to 92 (66 residues), 29.2 bits, see alignment E=3.6e-10

Best Hits

Swiss-Prot: 53% identical to FER3_NOSS1: Ferredoxin-3 (fdxB) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

KEGG orthology group: None (inferred from 95% identity to bph:Bphy_7733)

Predicted SEED Role

"4Fe-4S ferredoxin, nitrogenase-associated" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (100 amino acids)

>QEN71_RS42200 ferredoxin III, nif-specific (Paraburkholderia sabiae LMG 24235)
MNGTFSVKLPGGKIWTPAFVCSLDEQKCIGCGRCFRVCSQGVLQLVGVSEDGALIPFDDD
DEDEYQKKVMTIAHPQLCIGCTACAKICPKKCYRHVPAQI