Protein Info for QEN71_RS42100 in Paraburkholderia sabiae LMG 24235

Annotation: nodulation methyltransferase NodS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF05401: NodS" amino acids 6 to 196 (191 residues), 259.5 bits, see alignment E=8.2e-81 PF13489: Methyltransf_23" amino acids 36 to 153 (118 residues), 35.1 bits, see alignment E=3.8e-12 PF01209: Ubie_methyltran" amino acids 45 to 144 (100 residues), 20.5 bits, see alignment E=9.5e-08 PF13847: Methyltransf_31" amino acids 47 to 174 (128 residues), 38.4 bits, see alignment E=3.8e-13 PF08242: Methyltransf_12" amino acids 49 to 143 (95 residues), 58.3 bits, see alignment E=3.7e-19 PF13649: Methyltransf_25" amino acids 49 to 141 (93 residues), 55.3 bits, see alignment E=3.2e-18 PF08241: Methyltransf_11" amino acids 49 to 145 (97 residues), 58.9 bits, see alignment E=2.2e-19

Best Hits

Swiss-Prot: 67% identical to NODS_RHITR: Nodulation protein S (nodS) from Rhizobium tropici

KEGG orthology group: None (inferred from 97% identity to bph:Bphy_7716)

Predicted SEED Role

"N-methyl transferase nodS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>QEN71_RS42100 nodulation methyltransferase NodS (Paraburkholderia sabiae LMG 24235)
MRNVTNFELLRRELDADDPWQLDSNPFELQRHEQMLRMSLVDGSVSNALEVGCAGGAFTE
RLAPHCQRLTIIDVMPQALSKTRQRLKEPPNTVWIVSDVQHFLSLDKFDLIVVAEVLYYL
GNIEEVRAAIRNLVRMLVPGGRLIFGSARDASCRRWGHLAGAETILEILKEELTEVERVE
CAGESPNEDCLLARFRNRAFLSPQPNYPL