Protein Info for QEN71_RS41420 in Paraburkholderia sabiae LMG 24235

Annotation: C4-dicarboxylate transporter DctA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 62 (24 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 288 to 316 (29 residues), see Phobius details amino acids 323 to 338 (16 residues), see Phobius details amino acids 349 to 373 (25 residues), see Phobius details amino acids 384 to 400 (17 residues), see Phobius details PF00375: SDF" amino acids 8 to 400 (393 residues), 365.2 bits, see alignment E=2.1e-113

Best Hits

Swiss-Prot: 60% identical to DCTA_CHRVO: C4-dicarboxylate transport protein (dctA) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 60% identity to cvi:CV_3707)

MetaCyc: 54% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>QEN71_RS41420 C4-dicarboxylate transporter DctA (Paraburkholderia sabiae LMG 24235)
MGKVVKPLYVQVLIGVALGVAFGAIEPALGTDMKVLGDAFIKLVKMLVAPIVFATVVTGI
AKMGDIKAVGRVGLKALIYFEVVTTGALAIGLIVGHVMNPGGGMNVDPKTLNLSSVAGYA
KVAQEQSIKDFFMHIIPESFVGAFVHGDILPVVFIAVLFGLALAHAGERSATLVKIVDEF
LHTMFGVVTFVMKFAPIGAFGAIAFTVGKYGLTSLLALGQLMMAFYVTCIVFVLVVLGGV
LKLCGINIFRFIAYLKTEILITLGTSSAEPALPRLLEKLERMGCEKSVVGLVVPTGYAFN
LDGVCIYLTMAVVFIAQATNTHLTLGQELVILAMGLVTSKGMSGVPGGGFVALAATLSAV
HVLPLSAIALLVGIDRFMGEARSVTSIIGNAVAAVVIAKWEKAFDPQKMREALFHQSDVE
EELSDADAPKSVPAAVTEVHRPAGS