Protein Info for QEN71_RS40775 in Paraburkholderia sabiae LMG 24235

Annotation: UTP--glucose-1-phosphate uridylyltransferase GalU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01099: UTP--glucose-1-phosphate uridylyltransferase" amino acids 4 to 265 (262 residues), 377.8 bits, see alignment E=1.5e-117 PF00483: NTP_transferase" amino acids 11 to 266 (256 residues), 104.2 bits, see alignment E=4.3e-34

Best Hits

Swiss-Prot: 49% identical to YNGB_BACSU: Probable UTP--glucose-1-phosphate uridylyltransferase YngB (yngB) from Bacillus subtilis (strain 168)

KEGG orthology group: K00963, UTP--glucose-1-phosphate uridylyltransferase [EC: 2.7.7.9] (inferred from 90% identity to bte:BTH_I2634)

MetaCyc: 51% identical to UTP-glucose-1-phosphate uridylyltransferase (Bacillus subtilis subtilis 168)
UTP-monosaccharide-1-phosphate uridylyltransferase. [EC: 2.7.7.64, 2.7.7.9]

Predicted SEED Role

"UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)" (EC 2.7.7.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.9

Use Curated BLAST to search for 2.7.7.64 or 2.7.7.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>QEN71_RS40775 UTP--glucose-1-phosphate uridylyltransferase GalU (Paraburkholderia sabiae LMG 24235)
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGIADMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKAKLLELVRSIKPSHVDCFYVRQPEALGSGHAILCAEK
LVGDNPFAVILADDLLHGAPPVMKQMVDVFDHYHSSVIGVEEIAPEDSRSYGVIDGKLWE
DSIIKMSDIVEKPHPDVAPSNLGVVGRYVLKPRIFEHLRTLKPGESGELQLTDAIQALLA
DEQVLAHKYRGTRFDCGSKLGYLKATVEFALSHPEVAADFRAYLLEQFGSSCVDCTEV