Protein Info for QEN71_RS39980 in Paraburkholderia sabiae LMG 24235

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 141 to 149 (9 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 19 to 126 (108 residues), 45.4 bits, see alignment E=7e-16 PF00005: ABC_tran" amino acids 216 to 354 (139 residues), 55.2 bits, see alignment E=1.3e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>QEN71_RS39980 ATP-binding cassette domain-containing protein (Paraburkholderia sabiae LMG 24235)
MPVGVGQPNRILKSIAPALFYGVFAYGAMTTVITWWLYRPFIRLQFESTVAQADLRFGIL
HVRNCAETIAPYRGEQAEGTSIEKRLQRAVGVALATLRYQLVTNTAEAGLGLIWTLLPVL
VFVPLYFSGKITLGTVTQGAASAGLLLGAIQRMTGFVHTFATAAPHVVRLAQIVEKVQEV
EQEGAGRDDMITFHRGQVIRFNQLTVETPGRERTLLRNLCLTLSAGEHLLIMGQTGVGKS
SLLRAMAGLWRAGNGTITMPDTDEVLFLPQRPYMLLGSLREQILYPAIARVFTDSELQAF
LVEASLPDLAARHGGFDSVIDWSRVLSLGEQQRIGFTRALAAQARYVCLDEATSAVDVAT
EARLYEVDPVRRTDLRPAI