Protein Info for QEN71_RS39420 in Paraburkholderia sabiae LMG 24235

Annotation: (2Fe-2S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 20 to 73 (54 residues), 30.6 bits, E=2.6e-11
• PF01799: Fer2_2
  • amino acids 87 to 159 (73 residues), 99.9 bits, E=7.2e-33

Best Hits

Swiss-Prot: 51% identical to CUTC_SULAC: Glyceraldehyde dehydrogenase small chain (cutC) from Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)

KEGG orthology group: K03518, carbon-monoxide dehydrogenase small subunit [EC: 1.2.99.2] (inferred from 97% identity to bph:Bphy_6671)

MetaCyc: 80% identical to hmfC (Cupriavidus basilensis)
2-furoyl-CoA dehydrogenase. [EC: 1.3.99.8]

Predicted SEED Role

"Xanthine dehydrogenase iron-sulfur subunit (EC 1.17.1.4)" in subsystem Purine Utilization (EC 1.17.1.4)

MetaCyc Pathways

• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• superpathway of purines degradation in plants (14/18 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• adenosine nucleotides degradation II (4/5 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• guanosine nucleotides degradation III (3/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• ureide biosynthesis (5/7 steps found)
• furfural degradation (5/8 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• 5-hydroxymethylfurfural degradation (5/10 steps found)
• caffeine degradation III (bacteria, via demethylation) (1/7 steps found)
• theophylline degradation (1/9 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (1/10 steps found)

KEGG Metabolic Maps

• Methane metabolism
• Purine metabolism
• Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4, 1.2.99.2

Use Curated BLAST to search for 1.17.1.4 or 1.2.99.2 or 1.3.99.8

Protein Sequence (178 amino acids)

>QEN71_RS39420 (2Fe-2S)-binding protein (Paraburkholderia sabiae LMG 24235)
MSKSTPYVMRQGEQCAVTLTLNGRERSGYCETRELLSDFLRHELGATGTHVGCEHGVCGA
CTVHLDGVAVRSCLTLAVQAEGRRVDTVEGLAPAQTLGDLQQAFSRHHALQCGFCTAGIL
MSCADFLQRVPDPTEEQVRDMLSGHICRCTGYTPIVAAVLDCAARRKQQCESAEAEHA