Protein Info for QEN71_RS39375 in Paraburkholderia sabiae LMG 24235

Annotation: HlyD family efflux transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details PF16576: HlyD_D23" amino acids 69 to 297 (229 residues), 44.2 bits, see alignment E=3.7e-15 PF13533: Biotin_lipoyl_2" amino acids 70 to 116 (47 residues), 27.3 bits, see alignment 6.3e-10 PF00529: CusB_dom_1" amino acids 203 to 355 (153 residues), 38.1 bits, see alignment E=3e-13 PF13437: HlyD_3" amino acids 226 to 306 (81 residues), 54.9 bits, see alignment E=3.3e-18

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 80% identity to bge:BC1002_1557)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>QEN71_RS39375 HlyD family efflux transporter periplasmic adaptor subunit (Paraburkholderia sabiae LMG 24235)
MGDSVTSGNELARSAASKGTEAAAQSRRKRLIALLAAAVAAAGAAYGTYYFKWGRYHEAT
DDAYVSGNLVELTPQVTGTVTAVNADDTQIVKTGEPVVALDPADARNALSKAEAELGQTV
RRVSSLYVNNDFYAANVAQRRSELARVTNDLRRREAVADSGAVSAEDIAHARDAVNAAQA
ALDAARQQDEANHALTDRTTVEQHPDVQAAESKVRDAWLAYARNTLPAPVTGYVAKRSVQ
VGQRVSPGTPLMAIVPLDGVWVDANFKEVQLKRMRIGQPVVLIADVYGSGMTYHGQIEGF
SAGTGSAFATLPAQNATGNWIKIVQRLPVRIRLDQRELAAHPLRIGLSMQVKVDTRDDSG
TQLAAASNTSYRTDVFAQYGSQADREIAKLVAQNEMASRATAAKPTPKSAESRTPTDGAT
ARRRPLAAAQGGDA