Protein Info for QEN71_RS39365 in Paraburkholderia sabiae LMG 24235

Annotation: DHA2 family efflux MFS transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details amino acids 370 to 393 (24 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details amino acids 486 to 503 (18 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 21 to 503 (483 residues), 472.8 bits, see alignment E=6.3e-146 PF06609: TRI12" amino acids 22 to 303 (282 residues), 33.1 bits, see alignment E=2.3e-12 PF07690: MFS_1" amino acids 25 to 419 (395 residues), 178.3 bits, see alignment E=2.1e-56

Best Hits

Swiss-Prot: 48% identical to EMRY_ECOLI: Probable multidrug resistance protein EmrY (emrY) from Escherichia coli (strain K12)

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 82% identity to bgf:BC1003_0609)

MetaCyc: 48% identical to tripartite efflux pump membrane subunit EmrY (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-365

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>QEN71_RS39365 DHA2 family efflux MFS transporter permease subunit (Paraburkholderia sabiae LMG 24235)
MNHESDHSAKTPLTGIKFVLGTFAVALATFMNVLDSSIANVAIPTLSGNLGVSVDEGTWV
ITLFAAANAVSIPLTGWLTQRIGQVKLFVWAILLFVLSSAACGLAPNLLVLLAARVVQGL
VAGPLVPLSQALLLASFPEDKSSNALSLWAMTATVGPIAGPALGGWITDSYNWSWIFYIN
VPVGLFAAGVIWMVYRDRETPARKLPIDVIGLISLVAWVATLQIMLDKGKDLDWFNSPVI
WALTVVAAISFLFFLIWEFTEEKPVIDLRLFARRNFLGGTVAISVAYALFFANLVILPQW
IQGFLGYRAVDAGLVTAPLGIFSVMLAPLLGKIMPRSDSRVLATLAFVGFAGVFFMRSRY
TTDVDAFTLVLPTLLQGIPTALFFTPLTAIILSGLPPEKIPAAAGLSNFVRIFAGAVGTS
LLTTKWSDRTIFHHARLVDQTSVNNPNFINTIANLQTTLNFSTAKATALFESSLDAQASM
LGLNDVFWLSAVIFIVIVPLIWLTRPTRGASAPGAGGH