Protein Info for QEN71_RS39035 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 61 to 82 (22 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 258 to 282 (25 residues), see Phobius details amino acids 296 to 320 (25 residues), see Phobius details amino acids 332 to 349 (18 residues), see Phobius details amino acids 355 to 379 (25 residues), see Phobius details amino acids 389 to 413 (25 residues), see Phobius details amino acids 420 to 441 (22 residues), see Phobius details PF07690: MFS_1" amino acids 29 to 368 (340 residues), 163.9 bits, see alignment E=4.9e-52 amino acids 328 to 441 (114 residues), 33.6 bits, see alignment E=2.2e-12

Best Hits

Swiss-Prot: 49% identical to GUDP_BACSU: Probable glucarate transporter (gudP) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 67% identity to ebi:EbC_43240)

Predicted SEED Role

"D-glucarate permease" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>QEN71_RS39035 MFS transporter (Paraburkholderia sabiae LMG 24235)
MASHRTTQYISTESERMTRTRYSILATILLLATVAYADRAILSIAGPGISKQFGLNHVQL
GYVLSAFSWAYVIGQIPGGLLLDRFGTKKMYGATLILWSIATMLVGFIGNVTSDLSIALA
LLFALRFALGLIEAPSFPANGRVAVMWFPKEERGLATSLFASASYFAVAIFSPFAGWLTA
KFGWPAPFIALGLIGIASAGVWAVVMHEPRNHPRVSGAELDHIVAGGAMIDIDSKHELQA
RPAASWAMARTLLGNRMLWCSYIGQYCTIALSYFFITWFPIYLVQARGMNVMQAGFATMI
PAVAGFLGGIAGGAISDMLIRHGWSVSWARKTPYIVGMLVGCCLVLSAFTESNAVIVGLM
TLAFFGKGAAAGAGTWAIVSDTAPREAVGLAGAIFNCVGNIGGIVTPIAFGYIVQATGGY
TVGLYFVAAHCLVAAVVYLLFMGNIQRVKMS