Protein Info for QEN71_RS38745 in Paraburkholderia sabiae LMG 24235

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00106: adh_short" amino acids 14 to 213 (200 residues), 156 bits, see alignment E=1.3e-49 PF08659: KR" amino acids 17 to 183 (167 residues), 30 bits, see alignment E=7e-11 PF13561: adh_short_C2" amino acids 22 to 262 (241 residues), 183.8 bits, see alignment E=6.2e-58

Best Hits

Swiss-Prot: 52% identical to SQD_PSEPU: Sulfoquinovose 1-dehydrogenase (PpSQ1_00405) from Pseudomonas putida

KEGG orthology group: None (inferred from 50% identity to npp:PP1Y_Mpl1126)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>QEN71_RS38745 SDR family oxidoreductase (Paraburkholderia sabiae LMG 24235)
MNSTRPLYPALAGQVAFVSGGASGIGEAIVEAFWEQGAQVAFCDLDEQAGNALCERLGSA
NEGASSVKRLRPWFARCDVRDIDAYRNVLDEAARALGPIRTLVNNAGRDTRHALDDLSVD
MWNEMLAVNLTHHVFATQRVAPGMRAAGGGSIVNLGSISWLRGRPNLIGYTASKAAISGI
TRTLARELGDGGIRVNAVLPGAVVTARQTALWRDPAADQQFLDLQCLKFRVEPAHIADSV
LFLASPQAAAITGQNLIVDAGLAQVSVVG