Protein Info for QEN71_RS38515 in Paraburkholderia sabiae LMG 24235

Annotation: enoyl-CoA hydratase/isomerase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00378: ECH_1" amino acids 10 to 250 (241 residues), 168.9 bits, see alignment E=1.4e-53 PF16113: ECH_2" amino acids 15 to 186 (172 residues), 94.5 bits, see alignment E=9.2e-31

Best Hits

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 38% identity to rxy:Rxyl_2341)

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>QEN71_RS38515 enoyl-CoA hydratase/isomerase family protein (Paraburkholderia sabiae LMG 24235)
MNSSKVLYERHGTIALVTLDDPERRNALSREIVRGMSNALDTALRDGARSVVIAAAGTAF
CAGANIDDLRNGWMESPDPAEDPAVMFRRIAEFERPVIAAVHGAAVGGGMELTLACDLVV
AAESAWFSMPELGHGVIPNTGLALLARVVGMRRAFEIILTRRRVSSEEALNIGLVNRVLP
ESEVLDGALSLAAQIVESVPPGALKAARLNLRAHAAIDWDRVLRSPLDVPSEEWQEGLDA
FTQKRAPEYGRFWERRAM