Protein Info for QEN71_RS38080 in Paraburkholderia sabiae LMG 24235

Annotation: type III secretion system ATPase SctN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 TIGR02546: type III secretion apparatus H+-transporting two-sector ATPase" amino acids 35 to 452 (418 residues), 605.7 bits, see alignment E=3.9e-186 TIGR01026: ATPase, FliI/YscN family" amino acids 36 to 451 (416 residues), 535.9 bits, see alignment E=7.1e-165 PF02874: ATP-synt_ab_N" amino acids 46 to 106 (61 residues), 29.6 bits, see alignment E=1.2e-10 PF00006: ATP-synt_ab" amino acids 163 to 372 (210 residues), 286.6 bits, see alignment E=1.8e-89 PF18269: T3SS_ATPase_C" amino acids 379 to 450 (72 residues), 70.6 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 61% identical to HRPB6_XANEU: Probable ATP synthase hrpB6 (hrpB6) from Xanthomonas euvesicatoria

KEGG orthology group: K03224, ATP synthase in type III secretion protein SctN [EC: 3.6.3.14] (inferred from 89% identity to bam:Bamb_4222)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>QEN71_RS38080 type III secretion system ATPase SctN (Paraburkholderia sabiae LMG 24235)
MNTPSRETEIDDDALPLDGGRLVGDLDAGLAFFSPVSVQGRVNHAVGQILNATGIRARLG
EICELHTPDQPVRLAEVVGFSRQTTLLTPLGDVEGLSPETTVVPSGRAHMFAVGSSLFGR
VLDGLGAPLDGRGPVTGGAWVSTQQPPPNPLARRMIDTPFVTGVRVIDGLMTLGEGQRVG
IFAPSGVGKSTLLGMIARGAQADVNVIALVGERGREVREFIEHSLSPEVRARSILVVSTS
DRPAMERVKSALVATAIAEHFRDAGQRVLLLVDSLTRFARAQREVGLASGEPPTRRSFPP
STFAVLPRLLERAGQGERGSITALYTVLVEGDEESDPIAEEVRSILDGHIVLSRKIALAN
RYPAIDVLASLSRVMPLVTDAAHQRAAGRARELLAKYQEIELLVQIGEYREGSDRLGDLA
LRARDALAAFCAQSSTDNAPYEPTLARLAQLADAHV