Protein Info for QEN71_RS37945 in Paraburkholderia sabiae LMG 24235

Annotation: glutathione binding-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF13417: GST_N_3" amino acids 14 to 81 (68 residues), 22.3 bits, see alignment E=4e-08 PF14497: GST_C_3" amino acids 125 to 197 (73 residues), 24.4 bits, see alignment E=8.1e-09 PF13410: GST_C_2" amino acids 126 to 163 (38 residues), 28.5 bits, see alignment 4.1e-10 PF00043: GST_C" amino acids 127 to 189 (63 residues), 28.5 bits, see alignment E=4.6e-10

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 79% identity to bxe:Bxe_A2900)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>QEN71_RS37945 glutathione binding-like protein (Paraburkholderia sabiae LMG 24235)
MKLYIAQATCSLAVQAVFNELGLTPELVHFDVFGKTTSDQSDFAAVNDLLYVPALQLDGE
TEPLTETITIASYLADQHPESGLIPKHGTIERARMDQLLTFVATEIAQKHIPLMRKLMTP
EGIAFHSNKLLNAYGKLDARLADGRAYLTGEQFTVADAYVWATMWHERSGVNLDHLTHLK
AYIERIETRASVRKALQDEAEIVAAHKEAIAA