Protein Info for QEN71_RS37750 in Paraburkholderia sabiae LMG 24235

Annotation: cyanase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00673: cyanase
  • amino acids 8 to 156 (149 residues), 198.8 bits, E=2.3e-63
• PF21291: CYNS_N
  • amino acids 11 to 79 (69 residues), 108.5 bits, E=1.3e-35
• PF02560: Cyanate_lyase
  • amino acids 88 to 153 (66 residues), 108.5 bits, E=1.2e-35

Best Hits

Swiss-Prot: 91% identical to CYNS_BURCM: Cyanate hydratase (cynS) from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD)

KEGG orthology group: K01725, cyanate lyase [EC: 4.2.1.104] (inferred from 91% identity to bam:Bamb_5946)

MetaCyc: 68% identical to cyanase (Escherichia coli K-12 substr. MG1655)
Cyanase. [EC: 4.2.1.104]

Predicted SEED Role

"Cyanate hydratase (EC 4.2.1.104)" in subsystem Cyanate hydrolysis (EC 4.2.1.104)

MetaCyc Pathways

• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• cyanate degradation (3/3 steps found)
• urea degradation I (3/3 steps found)
• superpathway of allantoin degradation in yeast (5/6 steps found)
• cyanuric acid degradation II (3/5 steps found)
• uracil degradation III (3/5 steps found)
• cyanuric acid degradation I (2/5 steps found)
• superpathway of atrazine degradation (3/8 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.104

Protein Sequence (156 amino acids)

>QEN71_RS37750 cyanase (Paraburkholderia sabiae LMG 24235)
MTQSQTTQHAREALTETIIDAKTRKNLTFEAINEGTGLSIAFTTAALLGQHALPEKAAKL
VAERLGLDDAAVRLLQTIPLRGSIPGGVPTDPTVYRFYEMIQVYGSTLKALVHEQFGDGI
ISAINFKLDIKKVKDPEGGERAVITLDGKYLPTKPF