Protein Info for QEN71_RS37700 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 15 to 32 (18 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 88 to 112 (25 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 309 to 325 (17 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details amino acids 396 to 418 (23 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 383 (361 residues), 199.6 bits, see alignment E=7.1e-63 PF00083: Sugar_tr" amino acids 51 to 414 (364 residues), 48.2 bits, see alignment E=8e-17

Best Hits

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 97% identity to bph:Bphy_5675)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>QEN71_RS37700 MFS transporter (Paraburkholderia sabiae LMG 24235)
MQSAVVGVVRTASRFRWTVCALLFFATVINYMDRQILGLLAPLLQHEIGWTQVQYGRIVI
AFSAFYAIGLLCFGRVVDWLGTRISYAGAMLIWSIAAMLHAAVGSVMGFAAVRALLGIGE
GGNFPAAIKTTAEWFPRRERALATGIFNSGANIGAVFAPAIIPAIAVMYGWRAAFVIIGA
IGIVWLAVWLAVYRPADRSAQDEAFDEPRDEVEALDARHANARAPGWGELIKKRETWAFL
IGKFLTDPVWWFYLFWLPKWLNESRGMDMQHIGLPLVVIYAITTVGSIGGGWISSSLLRK
GWTVNAARKTAMLICACCVLPIAFVSQAENLWVAVGIVGLAAAAHQGWSANLFTTASDLF
PRRALGAVVGIGGMAGSIGGVLFSEVIGQVLQRTGHYWVLFAIGALAYLLALAIMHVLTP
RMSPAKLDA