Protein Info for QEN71_RS37130 in Paraburkholderia sabiae LMG 24235

Annotation: HAD family phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00702: Hydrolase" amino acids 7 to 184 (178 residues), 92.8 bits, see alignment E=5.6e-30 PF13419: HAD_2" amino acids 9 to 189 (181 residues), 81.3 bits, see alignment E=1.5e-26 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 82 to 190 (109 residues), 46.6 bits, see alignment E=4e-16 PF13242: Hydrolase_like" amino acids 145 to 190 (46 residues), 30.6 bits, see alignment 3.8e-11

Best Hits

KEGG orthology group: None (inferred from 90% identity to bph:Bphy_5788)

Predicted SEED Role

"Putative phosphatase YieH" in subsystem 2-phosphoglycolate salvage

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>QEN71_RS37130 HAD family phosphatase (Paraburkholderia sabiae LMG 24235)
MSAFPFDAVLFDCDGVLVDSETITNTVLTAMLGDLGWQLSIDEAMSIFVGKTVMDEAPLI
EAKTGVKITPAWLESFRERRNAALDREVMAIEGIAATVADLHARLSGKIAVASGADRLKI
RLMLAKIGVLEYFDGHIFSGHETARNKPHPDVYLAAAAGLGVDPARCAVVEDTVTGATAG
RAAGATVFGYSPSEKGHSSKAALRTVGVAEVFEEMAHLPALLAGWQH