Protein Info for QEN71_RS36690 in Paraburkholderia sabiae LMG 24235

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 36 to 239 (204 residues), 32.1 bits, see alignment E=2.5e-11 PF12695: Abhydrolase_5" amino acids 36 to 125 (90 residues), 31.8 bits, see alignment E=3e-11 PF12697: Abhydrolase_6" amino acids 37 to 250 (214 residues), 102.5 bits, see alignment E=1.3e-32 PF12146: Hydrolase_4" amino acids 70 to 232 (163 residues), 29.7 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: None (inferred from 93% identity to bph:Bphy_5834)

Predicted SEED Role

"Probable signal peptide protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>QEN71_RS36690 alpha/beta hydrolase (Paraburkholderia sabiae LMG 24235)
MNSLVRKCIASVMLAGSVLSLNAAQAAQPQDLKGKSVVLVHGAFADGSSWEKVIPLLEAR
GLHVVAVQNPLSSLADDAAAAKRAIDAQNGPVVLVGHSWGGAVITQAGNDDKVKALVYVA
AFAPDSGQSLNDVLKGKPAPAWVSELQKDSGNFLTLSTKAIDNDFAQDLSPAQKRIVAAT
QGPWFAGATDDKVTDAAWHSKPTYYVVANHDRMIDPRLQDAMAAQMKAKVTHLDSSHVPM
LSKPEAVANAIIEAAAKAQ