Protein Info for QEN71_RS36595 in Paraburkholderia sabiae LMG 24235

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 27 to 51 (25 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 210 to 235 (26 residues), see Phobius details amino acids 240 to 250 (11 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 99 to 290 (192 residues), 70.9 bits, see alignment E=5.9e-24

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 78% identity to bug:BC1001_4094)

Predicted SEED Role

"Multiple sugar ABC transporter, membrane-spanning permease protein MsmF" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>QEN71_RS36595 sugar ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MSTSIARLPSARSRRTSASGRARNRAAFFFLLPGCALFALCVIYPILSSIALSFYNWDGM
TAKTFIGLANYVELFQADTFYVALKNNLIWLVFFLLAPPLGLMFALYLNQQVKGMRVVKS
LFFAPFVLSGVVVGLVFSWFYDPTFGLLKVIVGHGIPVLGDSHTVTFGIVFAALWPQTPY
CMVLYLTGLTSINPEVVEAARMEGAKGWRLLWHVILPQLRPATFMAVVLTVIGALRSFDL
IAVMSGGGPFDSSTVLAYYMYDQAIKYYREGYSAAIAVVLFAIMLVYIVFHLRRMLREER