Protein Info for QEN71_RS36440 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 24 to 47 (24 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 210 to 396 (187 residues), 37.5 bits, see alignment E=1.1e-13

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 50% identity to rru:Rru_A2046)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>QEN71_RS36440 ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MTVNDSKSLKAKLRSAERTERVKAFMLVAPLLIFLLVTFLVPIGSLLMKSFRDPTLSQEM
PHASVLLREWDPSGGKLPGEQVYDAFARDLIAAKGSEGVSRIASRLNYDEAGMRSLLMKT
ARRLGDEGTGTWHERLTGIDARWNDIAAWSTLKYASSPWTLGYYLKAFDFKRDTHGAIVR
QGEGERLYVSVFIRTAWVSIAVSALCLLFGYPVAFFLANIPARYSNLFMIMVLLPFWTSI
LVRTTAWVVVLQTNGVINDVLKHLGLTDHGLPLIYNRFGVLVAMTHILLPYAILSLYSVM
KGVPNIYMKAARSLGAGPIRSFFQAYFPQTLPGVGAAGMLTFILAVGYYITPAIVGGPDD
QLASYYIANHVNNTLNWGLASALASILLGGVLLIYGVFVRMTGGAGVKLG