Protein Info for QEN71_RS36155 in Paraburkholderia sabiae LMG 24235

Annotation: GTP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF03308: MeaB" amino acids 35 to 276 (242 residues), 201 bits, see alignment E=4e-63 PF02492: cobW" amino acids 48 to 212 (165 residues), 39.3 bits, see alignment E=1.1e-13 PF01656: CbiA" amino acids 55 to 247 (193 residues), 29.7 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: K07588, LAO/AO transport system kinase [EC: 2.7.-.-] (inferred from 52% identity to reh:H16_B1839)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.-.-

Use Curated BLAST to search for 2.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>QEN71_RS36155 GTP-binding protein (Paraburkholderia sabiae LMG 24235)
MSDASETASVVGIGRRQLARDLSKIARASVAESLQLLREAGTVPARRIGFTGPPGAGKST
LIGRVAKARAARDESIAIIAIDPSSPATSGALLGDRVRMDAVLADTDVFIRSLPSGWSAD
GLSDNLADVLAAVEADGFGEILLESVGVGQVENGARALVDTLVLALGPQSGDQIQAMKAG
VLETADIVVVNKCDLPGAERMAQDIRNVLERNRANGRRVAPVLLTRANDEASIGQLSNAI
DEHTQWRAAHLDVARVAETRKRFHVRSLLTRRVAELIDALPDDAPTASVAELYAHIAKQI
SGSG