Protein Info for QEN71_RS36120 in Paraburkholderia sabiae LMG 24235

Annotation: DUF1479 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF07350: Gig2-like" amino acids 7 to 411 (405 residues), 475.5 bits, see alignment E=6.5e-147

Best Hits

Swiss-Prot: 45% identical to YBIU_ECOLI: Uncharacterized protein YbiU (ybiU) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to bxe:Bxe_A2192)

Predicted SEED Role

"FIG074102: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>QEN71_RS36120 DUF1479 domain-containing protein (Paraburkholderia sabiae LMG 24235)
MALKIDDLPGAIRQAKKELRAALPNYREVFAEVEAAISEEAKRIAAQRNRGEDVIPEIQF
SDIAQRRVTAEQIALVKARGACVIRKVFPSELVQGWDEDIAHYVERNNLDKRLENRAEDK
YFGQLASSKPQIYGVYWSKPQVLARQSASLTAARVFLNKLWRNESDGRVHFDPEHVPVYA
DRLRRRPPGSASLGLSAHCDGGSVERWIESNFRKVYRHVFSGNWRDYDPFDAAFRTDVEE
IPSPAVCSMFRTFQGWTALTPQGPGDGTLQLVPVANSMVYILLRALQDDVADDDLCGAMP
GRALSIKQDFHAPLFEALSSIPKMEAGDTVFWHSDVIHAVEDEHKGAGYSNVMYIASVPG
CAKNDAYLKRQLPSFLKGESPPDFPTDHFEVDFTGRATADDLTALGQAQLGFDL